- Recombinant Shewanella baltica Cell division protein ZipA homolog (zipA)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1016643
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 39,590 Da
- E Coli or Yeast
- Cell division protein ZipA homolog (zipA)
- 1-356
Sequence
MEDLQLVLFVLGAIAIVAVLVHGFWSIRRQQPKSLKDSPMGNFYKKQAEKGESIPKRIDAEGFDADGIGAVRVRKAGELAPNNETPTANPYLKQEVKLETKPQELTSPEFKAELKQGLKPELKVEAKHEPIPAQPDFSLQPPVAKEQHRGPKVSRQEPVLGTQVPQMGQSHAAIVAQKAAEQEQALRAAPQQSALFEENEHQADHQEEAFVEQAAEDELGEPRDVLVLHVVAKDGQQLNGAELLPCFLTLNFKYGDMNIFHRHVDNAGNGKVLFSIANMLKPGVFDPDNMEQFSTQGVVFFMTLPCYGDALMNFSIMLNSARQLAEEIDAVVLDGQRLPWGEFTKQDYLHRIRANA